PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr017879.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 450aa    MW: 48720 Da    PI: 5.2799
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr017879.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS365.48e-112874463374
         GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                   lLl+cAe+v+ ++l  a+ lL ++ el+sp g++ +R+ ayf  AL++r+ +s+ ++y+ l+ ++ +  +s++ ++ l+ ++ +sP++kfsh+t Nq
  Pbr017879.1  87 GLLLQCAEFVAMDSLDDASDLLPEIAELSSPFGSSPERVGAYFSHALQTRVISSCLGTYSPLANKTLTLAQSQRIFNGLQSYNSISPLVKFSHFTSNQ 184
                  58******************************************************************999999999********************* PP

         GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                  aI +a++ge++vH+iD+di+qGlQWp L++ LasR+++  s+RiTg+gs    s+e l++tg+rLa+fA++lg+pfef++l  k  +  +l++L ++p
  Pbr017879.1 185 AIFQALDGEDHVHVIDLDIMQGLQWPGLFHILASRSKKIRSMRITGFGS----SSELLQSTGRRLADFASSLGLPFEFQPLEGKIGSITDLSQLGIRP 278
                  *************************************************....9**************************988888999********* PP

         GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivn 296
                   Ea++V++++  h l+d ++s       +L+l+ sl+Pk++ ++eq+++h s+sFl rf+eal+yysalfd+l  +l+++s er++vE++l+g ei+n
  Pbr017879.1 279 SEATVVHWMH--HCLYDVTGSDLA----TLRLLGSLRPKLIMIAEQDLSH-SGSFLSRFVEALHYYSALFDALGDGLGADSLERHMVEQQLFGCEIRN 369
                  *********9..888877777777....**********************.899******************************************** PP

         GRAS 297 vvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  ++a  g +r+ + + +e+W + l+++GF+pv+l+ + a+qa+lll +++++gy++ ee+g+l lgWkd +L+++SaW+
  Pbr017879.1 370 ILAVGGPKRTGEVK-VERWGDELKRVGFGPVSLGGNPAAQASLLLGMFPWKGYTLVEENGCLKLGWKDLSLLTASAWQ 446
                  ********998887.9*************************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.44659426IPR005202Transcription factor GRAS
PfamPF035142.8E-10987446IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048366Biological Processleaf development
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MLQSLVPQSP IAAATPSNNN PTSSSSSMKT KRVDRDLAGS GSGDSDAEDP SFTKRPNSGR  60
NFRESTADDR DTEPVAEGES DGLRLLGLLL QCAEFVAMDS LDDASDLLPE IAELSSPFGS  120
SPERVGAYFS HALQTRVISS CLGTYSPLAN KTLTLAQSQR IFNGLQSYNS ISPLVKFSHF  180
TSNQAIFQAL DGEDHVHVID LDIMQGLQWP GLFHILASRS KKIRSMRITG FGSSSELLQS  240
TGRRLADFAS SLGLPFEFQP LEGKIGSITD LSQLGIRPSE ATVVHWMHHC LYDVTGSDLA  300
TLRLLGSLRP KLIMIAEQDL SHSGSFLSRF VEALHYYSAL FDALGDGLGA DSLERHMVEQ  360
QLFGCEIRNI LAVGGPKRTG EVKVERWGDE LKRVGFGPVS LGGNPAAQAS LLLGMFPWKG  420
YTLVEENGCL KLGWKDLSLL TASAWQPLD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-47854464375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009375331.10.0PREDICTED: scarecrow-like protein 23
SwissprotQ9FHZ10.0SCL23_ARATH; Scarecrow-like protein 23
TrEMBLD9ZJB30.0D9ZJB3_MALDO; SCL domain class transcription factor
STRINGGLYMA11G10220.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20683489
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41920.10.0GRAS family protein